Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast PPX1 protein

This Yeast PPX1 protein spans the amino acid sequence from region 1-397aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metaphosphatase

UniProt

P38698

Expression Region

1-397aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-397aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTPCR Rabbit pAb
E2514944 100 µL

NTPCR Rabbit pAb

Sign In for Pricing
View Details
hsa-miR-4266 miRNA Agomir
MBS8311748-01 5 nmol

hsa-miR-4266 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4266 miRNA Agomir
MBS8311748-02 10 nmol

hsa-miR-4266 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4266 miRNA Agomir
MBS8311748-03 20 nmol

hsa-miR-4266 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-4266 miRNA Agomir
MBS8311748-04 5x 20 nmol

hsa-miR-4266 miRNA Agomir

Sign In for Pricing
View Details
RNF7 Rabbit mAb
AB103430 100 µL

RNF7 Rabbit mAb

Sign In for Pricing
View Details