Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast PPX1 protein

This Yeast PPX1 protein spans the amino acid sequence from region 1-397aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metaphosphatase

UniProt

P38698

Expression Region

1-397aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-397aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (Azide free) (HRP)
MBS6327330-01 0.2 mL

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (Azide free) (HRP)
MBS6327330-02 5x 0.2 mL

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (Azide free) (HRP)

Sign In for Pricing
View Details
NDR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV810659 1.0 µg DNA

NDR1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Morus rubra Lectin (MRL) - Macrobeads
21511247-3 25 mL

Morus rubra Lectin (MRL) - Macrobeads

Sign In for Pricing
View Details
AxyGem Crystallography Plate
orb1734869 10 PCS

AxyGem Crystallography Plate

Sign In for Pricing
View Details
TAF12 Rabbit Polyclonal Antibody (PE)
orb2609857 100 µg

TAF12 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details