What is the catalog number for Bacterial LUXS protein?

The catalog number for Bacterial LUXS protein is orb419099.

What sizes are available for Bacterial LUXS protein?

Bacterial LUXS protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial LUXS protein come in?

Bacterial LUXS protein is available in 3 different pack sizes.

Is Bacterial LUXS protein in stock?

Bacterial LUXS protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial LUXS protein

This Bacterial LUXS protein spans the amino acid sequence from region 1-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AI-2 synthesis protein Autoinducer-2 production protein LuxS

UniProt

O34667

Expression Region

1-157aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-157aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG