Mouse KLK8 protein
This Mouse KLK8 protein spans the amino acid sequence from region 33-260aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Neuropsin
UniProt
Q61955
Expression Region
33-260aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 33-260aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AN300617L-01 50 µL
Recombinant Histone H3 (Di Methyl Lys4) Monoclonal Antibody
Sign In for Pricing
View Details AN300617L-02 100 µL
Recombinant Histone H3 (Di Methyl Lys4) Monoclonal Antibody
Sign In for Pricing
View Details MBS725515-01 48 Well
Guinea Pig oxidized lowdensity lipoprotein ELISA Kit
Sign In for Pricing
View Details MBS725515-02 96 Well
Guinea Pig oxidized lowdensity lipoprotein ELISA Kit
Sign In for Pricing
View Details MBS725515-03 5x 96 Well
Guinea Pig oxidized lowdensity lipoprotein ELISA Kit
Sign In for Pricing
View Details MBS725515-04 10x 96 Well
Guinea Pig oxidized lowdensity lipoprotein ELISA Kit
Sign In for Pricing
View Details