Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial CTXB protein

This Bacterial CTXB protein spans the amino acid sequence from region 22-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid

UniProt

P01556

Expression Region

22-124aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 22-124aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1058052-01 0.02 mg (E-Coli)

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1058052-02 0.02 mg (Yeast)

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1058052-03 0.1 mg (E-Coli)

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1058052-04 0.1 mg (Yeast)

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1058052-05 0.02 mg (Baculovirus)

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1058052-06 0.02 mg (Mammalian-Cell)

Recombinant Shewanella pealeana 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details