Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP4B protein

This Human ATP4B protein spans the amino acid sequence from region 58-291aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gastric H (+) /K (+) ATPase subunit beta Proton pump beta chain

UniProt

P51164

Expression Region

58-291aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-TaggedExpression Region: 58-291aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PFN2 shRNA (UAS) - Lentiviral human PFN2 shRNA (UAS) (25)
GTR15097901 1 Vial

Lentiviral human PFN2 shRNA (UAS) - Lentiviral human PFN2 shRNA (UAS) (25)

Sign In for Pricing
View Details
GIP Rabbit pAb
MBS8545960-01 0.1 mL

GIP Rabbit pAb

Sign In for Pricing
View Details
GIP Rabbit pAb
MBS8545960-02 0.1 mL (AF405L)

GIP Rabbit pAb

Sign In for Pricing
View Details
GIP Rabbit pAb
MBS8545960-03 0.1 mL (AF405S)

GIP Rabbit pAb

Sign In for Pricing
View Details
GIP Rabbit pAb
MBS8545960-04 0.1 mL (AF610)

GIP Rabbit pAb

Sign In for Pricing
View Details
GIP Rabbit pAb
MBS8545960-05 0.1 mL (AF635)

GIP Rabbit pAb

Sign In for Pricing
View Details