Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Non-specific lipid-transfer protein

This Plant Non-specific lipid-transfer protein spans the amino acid sequence from region 1-37aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pollen allergen Art v 3 Allergen, Art v 3

UniProt

P0C088

Expression Region

1-37aa

Tag

Tag-Free

Source

E.coli

Origin

Artemisia vulgaris (Mugwort)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

3.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-TaggedExpression Region: 1-37aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN1 antibody
MBS5310763-01 0.05 mL

ACTN1 antibody

Sign In for Pricing
View Details
ACTN1 antibody
MBS5310763-02 5x 0.05 mL

ACTN1 antibody

Sign In for Pricing
View Details
MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (MaxLight 405)
MBS6196681-01 0.1 mL

MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (MaxLight 405)

Sign In for Pricing
View Details
MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (MaxLight 405)
MBS6196681-02 5x 0.1 mL

MEF2A (Myocyte Enhancer Factor 2A, ADCAD1, RSRFC4, RSRFC9) (MaxLight 405)

Sign In for Pricing
View Details
Anti-RIMS1 Antibody
CTA3169-01 30 µL

Anti-RIMS1 Antibody

Sign In for Pricing
View Details
Anti-RIMS1 Antibody
CTA3169-02 50 μL

Anti-RIMS1 Antibody

Sign In for Pricing
View Details