Human Outer capsid protein VP4 protein
This Human Outer capsid protein VP4 protein spans the amino acid sequence from region 1-249aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hemagglutinin
UniProt
A9Q1L0
Expression Region
1-249aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-taggedExpression Region: 1-249aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EIA05550Gu 1 Kit
Guinea pig Cytochrome P450c21/21-hydroxylase (CYP21B) ELISA Kit
Sign In for Pricing
View Details 
MBS6256556-01 0.1 mL
CD154 (CD40 Ligand, CD40-L, CD40L, CD40LG, gp39, hCD40L, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5) (MaxLight 750)
Sign In for Pricing
View Details MBS6256556-02 5x 0.1 mL
CD154 (CD40 Ligand, CD40-L, CD40L, CD40LG, gp39, hCD40L, HIGM1, IGM, IMD3, T-BAM, T-cell Antigen GP39, TNF-related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, TNF Ligand Superfamily Member 5, TNFSF5) (MaxLight 750)
Sign In for Pricing
View Details 
030938-AP 200 µL
EIF4E2 (EIF4E2, EIF4EL3, Eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E homologous protein, Eukaryotic translation initiation factor 4E-like 3, eIF4E-like protein 4E-LP, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3) (AP) discontinued
Sign In for Pricing
View Details