What is the catalog number for Human Outer capsid protein VP4 protein?

The catalog number for Human Outer capsid protein VP4 protein is orb419085.

What sizes are available for Human Outer capsid protein VP4 protein?

Human Outer capsid protein VP4 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human Outer capsid protein VP4 protein come in?

Human Outer capsid protein VP4 protein is available in 3 different pack sizes.

Is Human Outer capsid protein VP4 protein in stock?

Human Outer capsid protein VP4 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human Outer capsid protein VP4 protein

This Human Outer capsid protein VP4 protein spans the amino acid sequence from region 1-249aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hemagglutinin

UniProt

A9Q1L0

Expression Region

1-249aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-249aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR