Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Miraculin protein

This Plant Miraculin protein spans the amino acid sequence from region 30-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Miraculin, MIR

UniProt

P13087

Expression Region

30-220aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 30-220aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Git2 (NM_001077360) Mouse Untagged Clone
MC220431 10 µg

Git2 (NM_001077360) Mouse Untagged Clone

Sign In for Pricing
View Details
COL25A1 Antibody
orb676328-01 50 µg

COL25A1 Antibody

Sign In for Pricing
View Details
COL25A1 Antibody
orb676328-02 100 µg

COL25A1 Antibody

Sign In for Pricing
View Details
CDH23 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-15498R-BF750 100 µL

CDH23 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PEDF Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-0731R-BF405 100 µL

PEDF Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
RPL8 Antibody
OAGA05797-100UL 100 µL

RPL8 Antibody

Sign In for Pricing
View Details