Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial HLB protein

This Bacterial HLB protein spans the amino acid sequence from region 35-330aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-hemolysin Beta-toxin Sphingomyelinase

UniProt

P09978

Expression Region

35-330aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 35-330aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOBEC3B Rabbit Polyclonal Antibody
S0B1100-01 1 mL

APOBEC3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APOBEC3B Rabbit Polyclonal Antibody
S0B1100-02 25 µL

APOBEC3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APOBEC3B Rabbit Polyclonal Antibody
S0B1100-03 100 µL

APOBEC3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal UFD1L Antibody (2A6F3)
NBP2-61829 0.1 mL

Mouse Monoclonal UFD1L Antibody (2A6F3)

Sign In for Pricing
View Details
GIMAP4
CSB-CL885732HU 10 μg Plasmid + 200 μL Glycerol

GIMAP4

Sign In for Pricing
View Details
ANKUB1 siRNA Oligos set (Human)
12034171 3x 5 nmol

ANKUB1 siRNA Oligos set (Human)

Sign In for Pricing
View Details