Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CALR protein

This Human CALR protein spans the amino acid sequence from region 18-417aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRP55 Calregulin Endoplasmic reticulum resident protein 60

UniProt

P27797

Expression Region

18-417aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 18-417aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Medium for Mouse Lingual Epidermal Cells (LiEC)
abx710351-01 100 mL

Medium for Mouse Lingual Epidermal Cells (LiEC)

Sign In for Pricing
View Details
Medium for Mouse Lingual Epidermal Cells (LiEC)
abx710351-02 500 mL

Medium for Mouse Lingual Epidermal Cells (LiEC)

Sign In for Pricing
View Details
Medium for Mouse Lingual Epidermal Cells (LiEC)
abx710351-03 1 L

Medium for Mouse Lingual Epidermal Cells (LiEC)

Sign In for Pricing
View Details
CD305 (Leukocyte-associated Immunoglobulin-like Receptor 1, LAIR1, LAIR-1, hLAIR1) (MaxLight 750)
MBS6232008-01 0.1 mL

CD305 (Leukocyte-associated Immunoglobulin-like Receptor 1, LAIR1, LAIR-1, hLAIR1) (MaxLight 750)

Sign In for Pricing
View Details
CD305 (Leukocyte-associated Immunoglobulin-like Receptor 1, LAIR1, LAIR-1, hLAIR1) (MaxLight 750)
MBS6232008-02 5x 0.1 mL

CD305 (Leukocyte-associated Immunoglobulin-like Receptor 1, LAIR1, LAIR-1, hLAIR1) (MaxLight 750)

Sign In for Pricing
View Details
Troponin I, cardiac muscle, PHOSPHORYLATED (Cardiac Troponin I, TNNI3, TNNC1) (HRP)
T8665-18M-HRP 100 µL

Troponin I, cardiac muscle, PHOSPHORYLATED (Cardiac Troponin I, TNNI3, TNNC1) (HRP)

Sign In for Pricing
View Details