E. coli ACPP protein
This E. coli ACPP protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cytosolic-activating factor
UniProt
P0A6A8
Expression Region
1-78aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-78aaSequence Info: Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
036131-APC 200 µL
GNAS, CT (GNAS, GNAS1, Neuroendocrine secretory protein 55, LHAL tetrapeptide, GPIPIRRH peptide) (APC) discontinued
Sign In for Pricing
View Details 
MBS1017321-01 0.02 mg (E-Coli)
Recombinant Cryptococcus neoformans var. neoformans serotype D Actin-like protein ARP6 (ARP6)
Sign In for Pricing
View Details MBS1017321-02 0.02 mg (Yeast)
Recombinant Cryptococcus neoformans var. neoformans serotype D Actin-like protein ARP6 (ARP6)
Sign In for Pricing
View Details MBS1017321-03 0.1 mg (E-Coli)
Recombinant Cryptococcus neoformans var. neoformans serotype D Actin-like protein ARP6 (ARP6)
Sign In for Pricing
View Details MBS1017321-04 0.1 mg (Yeast)
Recombinant Cryptococcus neoformans var. neoformans serotype D Actin-like protein ARP6 (ARP6)
Sign In for Pricing
View Details