Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ACPP protein

This E. coli ACPP protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic-activating factor

UniProt

P0A6A8

Expression Region

1-78aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-78aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leucine-rich α-2 Glycoprotein 1 (LRG1) Human ELISA Kit
99341 96 Tests

Leucine-rich α-2 Glycoprotein 1 (LRG1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable endonuclease C19F8.04c (SPBC19F8.04c), partial
MBS7070462 Inquire

Recombinant Schizosaccharomyces pombe Probable endonuclease C19F8.04c (SPBC19F8.04c), partial

Sign In for Pricing
View Details
Spaca9 Rat shRNA Lentiviral Particle (Locus ID 296610)
TL713563V 500 µL Each

Spaca9 Rat shRNA Lentiviral Particle (Locus ID 296610)

Sign In for Pricing
View Details
CDY3P CRISPR All-in-one AAV vector set (with saCas9)(Human)
15791151 3x 1.0 µg DNA

CDY3P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Lentiviral human UMPS sgRNA gene knockout kit - Lentiviral human UMPS sgRNA gene knockout kit (25)
GTR15368931 1 Vial

Lentiviral human UMPS sgRNA gene knockout kit - Lentiviral human UMPS sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
BRCA2 (Breast Cancer Type 2 Susceptibility Protein, Fanconi Anemia Group D1 Protein, FACD, FANCD1) (FITC)
123990-FITC 100 µL

BRCA2 (Breast Cancer Type 2 Susceptibility Protein, Fanconi Anemia Group D1 Protein, FACD, FANCD1) (FITC)

Sign In for Pricing
View Details