Mouse TMEM27 protein
This Mouse TMEM27 protein spans the amino acid sequence from region 15-141aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Transmembrane protein 27
UniProt
Q9ESG4
Expression Region
15-141aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
34.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 15-141aaSequence Info: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
583392-01 20 µg
3-demethoxyubiquinol 3-hydroxylase, Recombinant, E. coli, aa1-391, His-Tag
Sign In for Pricing
View Details 583392-02 100 µg
3-demethoxyubiquinol 3-hydroxylase, Recombinant, E. coli, aa1-391, His-Tag
Sign In for Pricing
View Details 
MBS735844-01 48 Well
Bovine Liver kidney microsome autoantibody ELISA Kit
Sign In for Pricing
View Details MBS735844-02 96 Well
Bovine Liver kidney microsome autoantibody ELISA Kit
Sign In for Pricing
View Details MBS735844-03 5x 96 Well
Bovine Liver kidney microsome autoantibody ELISA Kit
Sign In for Pricing
View Details MBS735844-04 10x 96 Well
Bovine Liver kidney microsome autoantibody ELISA Kit
Sign In for Pricing
View Details