Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse TMEM27 protein

This Mouse TMEM27 protein spans the amino acid sequence from region 15-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 27

UniProt

Q9ESG4

Expression Region

15-141aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 15-141aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHST1 ORF Vector (Human) (pORF)
ORF002362 1.0 µg DNA

CHST1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Porcine DEFb1 ELISA Kit
orb439098-01 48 Tests

Porcine DEFb1 ELISA Kit

Sign In for Pricing
View Details
Porcine DEFb1 ELISA Kit
orb439098-02 96 Tests

Porcine DEFb1 ELISA Kit

Sign In for Pricing
View Details
eIF4B (Phospho-Ser406) Rabbit mAb
MBS9468224-01 0.05 mL

eIF4B (Phospho-Ser406) Rabbit mAb

Sign In for Pricing
View Details
eIF4B (Phospho-Ser406) Rabbit mAb
MBS9468224-02 0.1 mL

eIF4B (Phospho-Ser406) Rabbit mAb

Sign In for Pricing
View Details
eIF4B (Phospho-Ser406) Rabbit mAb
MBS9468224-03 5x 0.1 mL

eIF4B (Phospho-Ser406) Rabbit mAb

Sign In for Pricing
View Details