Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DHODH protein

This Human DHODH protein spans the amino acid sequence from region 31-395aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dihydroorotate oxidase

UniProt

Q02127

Expression Region

31-395aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 31-395aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADAMTS15 shRNA (UAS) - Lentiviral human ADAMTS15 shRNA (UAS) plasmid
GTR15160303 1 Vial

Lentiviral human ADAMTS15 shRNA (UAS) - Lentiviral human ADAMTS15 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Cd70 3'UTR GFP Stable Cell Line
TU153524 1.0 mL

Cd70 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MYBL2 Protein Vector (Human) (pPB-N-His)
PV027266 500 ng

MYBL2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
AZD8931 diFuMaric acid
orb1298662-01 1 mg

AZD8931 diFuMaric acid

Sign In for Pricing
View Details
AZD8931 diFuMaric acid
orb1298662-02 5 mg

AZD8931 diFuMaric acid

Sign In for Pricing
View Details
AZD8931 diFuMaric acid
orb1298662-03 10 mg

AZD8931 diFuMaric acid

Sign In for Pricing
View Details