Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARF1 protein

This Human ARF1 protein spans the amino acid sequence from region 2-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP Ribosylation Factor 1, ADP-ribosylation factor 1, ARF 1, ARF1, ARF1_HUMAN

UniProt

P84077

Expression Region

2-181aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-taggedExpression Region: 2-181aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA4 (Carbonic Anhydrase IV, CAIV, Car4, RP17) (PE)
MBS6409181-01 0.1 mL

CA4 (Carbonic Anhydrase IV, CAIV, Car4, RP17) (PE)

Sign In for Pricing
View Details
CA4 (Carbonic Anhydrase IV, CAIV, Car4, RP17) (PE)
MBS6409181-02 5x 0.1 mL

CA4 (Carbonic Anhydrase IV, CAIV, Car4, RP17) (PE)

Sign In for Pricing
View Details
Rosiglitazone HCl
S2075-5mg 5 mg

Rosiglitazone HCl

Sign In for Pricing
View Details
APOOL (Biotin)
555307-01 50 µg

APOOL (Biotin)

Sign In for Pricing
View Details
APOOL (Biotin)
555307-02 100 µg

APOOL (Biotin)

Sign In for Pricing
View Details
Anti-SMTN Antibody Picoband®, FITC Conjugate
A04895-2-FITC 100 µg/Vial

Anti-SMTN Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details