Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Trypsin protein

This Plant Trypsin protein spans the amino acid sequence from region 25-121aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ITRL-2

UniProt

Q43691

Expression Region

25-121aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Triticum aestivum (Wheat)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 25-121aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKDSLLQDMSRCKKLTREFIAGIVGRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (T200/797), 1mg/mL
BNUM0797-50 1x 50 µL

CD45RO (T200/797), 1mg/mL

Sign In for Pricing
View Details
VPAC2 (VIPR2) (NM_003382) Human Over-expression Lysate
LC401152 20 µg

VPAC2 (VIPR2) (NM_003382) Human Over-expression Lysate

Sign In for Pricing
View Details
B3GNT1 (B3GNT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A9]
TA505283BM 100 µL

B3GNT1 (B3GNT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A9]

Sign In for Pricing
View Details
MELK (C-term) Rabbit Polyclonal Antibody
AP13790PU-N 400 µL

MELK (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAF1 Antibody
KC-1251-01 50 μL

NDUFAF1 Antibody

Sign In for Pricing
View Details
NDUFAF1 Antibody
KC-1251-02 100 µL

NDUFAF1 Antibody

Sign In for Pricing
View Details