Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC4A1 protein

This Human SLC4A1 protein spans the amino acid sequence from region 1-403aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anion exchange protein 1

UniProt

P02730

Expression Region

1-403aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-403aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit
MBS9354457-01 48 Well

Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit
MBS9354457-02 96 Well

Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit
MBS9354457-03 5x 96 Well

Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit
MBS9354457-04 10x 96 Well

Sheep Soluble Cell Adhesion Molecule 26 (sCD26) ELISA Kit

Sign In for Pricing
View Details
Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (MaxLight 550)
MBS6212098-01 0.1 mL

Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (MaxLight 550)

Sign In for Pricing
View Details
Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (MaxLight 550)
MBS6212098-02 5x 0.1 mL

Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (MaxLight 550)

Sign In for Pricing
View Details