Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DOCK8 protein

This Human DOCK8 protein spans the amino acid sequence from region 560-729aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOCK8Dedicator of cytokinesis protein 8

UniProt

Q8NF50

Expression Region

560-729aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 560-729aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNMB2 Polyclonal Antibody
E-AB-16540-01 20 µL

KCNMB2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNMB2 Polyclonal Antibody
E-AB-16540-02 60 µL

KCNMB2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNMB2 Polyclonal Antibody
E-AB-16540-03 120 µL

KCNMB2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNMB2 Polyclonal Antibody
E-AB-16540-04 200 µL

KCNMB2 Polyclonal Antibody

Sign In for Pricing
View Details
IL6 Antibody (Biotin)
KB-9272-01 50 μL

IL6 Antibody (Biotin)

Sign In for Pricing
View Details
IL6 Antibody (Biotin)
KB-9272-02 100 µL

IL6 Antibody (Biotin)

Sign In for Pricing
View Details