Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DOCK8 protein

This Human DOCK8 protein spans the amino acid sequence from region 560-729aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOCK8Dedicator of cytokinesis protein 8

UniProt

Q8NF50

Expression Region

560-729aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 560-729aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UVRAG activation kit by CRISPRa
GA105102 1 Kit

Human UVRAG activation kit by CRISPRa

Sign In for Pricing
View Details
ATP5F1B Rabbit Polyclonal Antibody
TA383784 100 µL

ATP5F1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
11b-Hydroxy Dienogest
TRC-H905400-5MG 5 mg

11b-Hydroxy Dienogest

Sign In for Pricing
View Details
Human ARPC5L activation kit by CRISPRa
GA113144 1 Kit

Human ARPC5L activation kit by CRISPRa

Sign In for Pricing
View Details
MAP2K1 Mouse Monoclonal Antibody [Clone ID: 13B6.G12]
TA396832 100 µg

MAP2K1 Mouse Monoclonal Antibody [Clone ID: 13B6.G12]

Sign In for Pricing
View Details
2-Hydroxyphenylboronic acid
TRC-H952913-250MG 250 mg

2-Hydroxyphenylboronic acid

Sign In for Pricing
View Details