Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DOCK8 protein

This Human DOCK8 protein spans the amino acid sequence from region 560-729aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOCK8Dedicator of cytokinesis protein 8

UniProt

Q8NF50

Expression Region

560-729aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 560-729aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium/sodium hyperpolarization-activated Cyclic nucleotide-gated channel 4 (HCN4) Rat ELISA Kit
G0366 96 Tests

Potassium/sodium hyperpolarization-activated Cyclic nucleotide-gated channel 4 (HCN4) Rat ELISA Kit

Sign In for Pricing
View Details
NR2E1 Rabbit Polyclonal Antibody
TA370886 100 µL

NR2E1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human HOMER2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAMLHOMER2AP97200UL 200 µL

Rabbit Anti Human HOMER2 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details
Hsa-miR-382-3p miRNA Antagomir
orb1914439-01 10 nmol

Hsa-miR-382-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-382-3p miRNA Antagomir
orb1914439-02 20 nmol

Hsa-miR-382-3p miRNA Antagomir

Sign In for Pricing
View Details
ATF7 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61320R-PE-Cy5-TR 20 µL

ATF7 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details