Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DOCK8 protein

This Human DOCK8 protein spans the amino acid sequence from region 560-729aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOCK8Dedicator of cytokinesis protein 8

UniProt

Q8NF50

Expression Region

560-729aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 560-729aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4GALT7 (NM_007255) Human Tagged ORF Clone
RC200258 10 µg

B4GALT7 (NM_007255) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to PYCARD
sAP-1344 50 µg

Mouse Monoclonal Antibody to PYCARD

Sign In for Pricing
View Details
MFAP1 293 Cell Lysate
401606 0.1 mg

MFAP1 293 Cell Lysate

Sign In for Pricing
View Details
TSPAN6 Rabbit Polyclonal Antibody (Biotin)
orb452631 100 µL

TSPAN6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse POU domain, class 5, transcription factor 1 (POU5F1) ELISA Kit
GTR10312398 96 Well

Mouse POU domain, class 5, transcription factor 1 (POU5F1) ELISA Kit

Sign In for Pricing
View Details
P-Nitrophenylphosphate Ditris Salt crystalline (PNPP-d) PrimeDx, 99%
76230 50 g

P-Nitrophenylphosphate Ditris Salt crystalline (PNPP-d) PrimeDx, 99%

Sign In for Pricing
View Details