Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DOCK8 protein

This Human DOCK8 protein spans the amino acid sequence from region 560-729aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DOCK8Dedicator of cytokinesis protein 8

UniProt

Q8NF50

Expression Region

560-729aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 560-729aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pT7-EGFP-EGFR-DEL19 Plasmid
PVT59345 2 µg

pT7-EGFP-EGFR-DEL19 Plasmid

Sign In for Pricing
View Details
Chloride Channel 5 (CLCN5) (NM_001127898) Human Tagged ORF Clone
RC226186 10 µg

Chloride Channel 5 (CLCN5) (NM_001127898) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRIM5 Rabbit Polyclonal Antibody
orb668504-01 100 µL

TRIM5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM5 Rabbit Polyclonal Antibody
orb668504-02 200 µL

TRIM5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRNAE23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV751691 1.0 µg DNA

TRNAE23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Peropsin Polyclonal Antibody
ABP53536-01 30 µL

Peropsin Polyclonal Antibody

Sign In for Pricing
View Details