Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPIFA2 protein

This Human BPIFA2 protein spans the amino acid sequence from region 19-249aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parotid secretory protein

UniProt

Q96DR5

Expression Region

19-249aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 14-249aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Mouse MHC II (I-A/I-E) Flow Cytometry Monoclonal Clone M5114 APC Ready To Use 200 Tests
IRTAMSMHCIIM5114CAPC200 200 Tests

Anti Mouse MHC II (I-A/I-E) Flow Cytometry Monoclonal Clone M5114 APC Ready To Use 200 Tests

Sign In for Pricing
View Details
IFN gamma Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2557991 100 µL

IFN gamma Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
IGF1R Knockout HAP1 Polyclonal Cells
ARG34725 1 Million

IGF1R Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
ZBTB9/ZNF919 Rabbit Polyclonal Antibody (PE-Cy5)
orb943061 100 µL

ZBTB9/ZNF919 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Enolase 1 Antibody / Alpha Enolase / ENO1
RQ5668 100 µg

Enolase 1 Antibody / Alpha Enolase / ENO1

Sign In for Pricing
View Details
Nhe-1 Antibody
MBS9413005-01 0.1 mL

Nhe-1 Antibody

Sign In for Pricing
View Details