Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bird Ovomucoid protein

This Bird Ovomucoid protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ovomucoid, Fragment

UniProt

P05600

Expression Region

1-52aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Coturnix delegorguei (Harlequin quail)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-52aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9130409I23Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3017807 1.0 µg DNA

9130409I23Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
MARVELD3 (m) : 293T Lysate
sc-121520 100 µg - 200 µL

MARVELD3 (m) : 293T Lysate

Sign In for Pricing
View Details
Goat Polyclonal AU1 Epitope Tag Antibody [HRP]
NB600-457 0.1 mL

Goat Polyclonal AU1 Epitope Tag Antibody [HRP]

Sign In for Pricing
View Details
Lentiviral human KIAA0586 shRNA (UAS) - Lentiviral human KIAA0586 shRNA (UAS, iRFP) (100)
GTR15296490 1 Vial

Lentiviral human KIAA0586 shRNA (UAS) - Lentiviral human KIAA0586 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
IFN gamma  polyclonal antibody
BS79745 50ul

IFN gamma polyclonal antibody

Sign In for Pricing
View Details
VIPR2 (VIPR2, C16DUPq36.3, DUP7q36.3, PACAP-R-3, Pvr3, Vip Type-2 Receptor, Vip-r2, Vip2 Receptor, PACAP Type III Receptor, Pacap Type-3, PACAP-R3, PACAPR-3, VIP and PACAP Receptor 2, VIP-R-2, VIP2R, VPAC2, VPCAP2R, PACAP3, Vip2, VPAC2R)
171403 50 µg

VIPR2 (VIPR2, C16DUPq36.3, DUP7q36.3, PACAP-R-3, Pvr3, Vip Type-2 Receptor, Vip-r2, Vip2 Receptor, PACAP Type III Receptor, Pacap Type-3, PACAP-R3, PACAPR-3, VIP and PACAP Receptor 2, VIP-R-2, VIP2R, VPAC2, VPCAP2R, PACAP3, Vip2, VPAC2R)

Sign In for Pricing
View Details