Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bird Ovomucoid protein

This Bird Ovomucoid protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ovomucoid, Fragment

UniProt

P05600

Expression Region

1-52aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Coturnix delegorguei (Harlequin quail)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-52aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)
231392-01 250 mg

3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)

Sign In for Pricing
View Details
3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)
231392-02 1 g

3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)

Sign In for Pricing
View Details
3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)
231392-03 5 g

3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)

Sign In for Pricing
View Details
3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)
231392-04 25 g

3- (4-Methylphenyl) -1H-pyrazole-4-carbaldehyde 98+% (HPLC)

Sign In for Pricing
View Details
Osteopontin Recombinant Rabbit Monoclonal Antibody (BF680)
orb2363345 100 µL

Osteopontin Recombinant Rabbit Monoclonal Antibody (BF680)

Sign In for Pricing
View Details
GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (PE)
127624-PE 100 µL

GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (PE)

Sign In for Pricing
View Details