Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bird Ovomucoid protein

This Bird Ovomucoid protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ovomucoid, Fragment

UniProt

P05600

Expression Region

1-52aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Coturnix delegorguei (Harlequin quail)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-52aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKAP Polyclonal Antibody, PE Conjugated
bs-13644R-PE 100 µL

IKAP Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Tef siRNA Oligos set (Mouse)
46479174 3x 5 nmol

Tef siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Mouse KLK1 siRNA
abx921836-01 15 nmol

Mouse KLK1 siRNA

Sign In for Pricing
View Details
Mouse KLK1 siRNA
abx921836-02 30 nmol

Mouse KLK1 siRNA

Sign In for Pricing
View Details
LOC500956 ORF Vector (Rat) (pORF)
ORF069733 1.0 µg DNA

LOC500956 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Chlorobenzene
sc-239517 250 mL

Chlorobenzene

Sign In for Pricing
View Details