Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BGN protein

This Human BGN protein spans the amino acid sequence from region 38-368aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone/cartilage proteoglycan I PG-S1

UniProt

P21810

Expression Region

38-368aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 38-368aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LACTB2 (NM_016027) Human Tagged Lenti ORF Clone
RC201465L4 10 µg

LACTB2 (NM_016027) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GATA5 Antibody, Biotin conjugated
MBS7044714-01 0.05 mg

GATA5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GATA5 Antibody, Biotin conjugated
MBS7044714-02 0.1 mg

GATA5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GATA5 Antibody, Biotin conjugated
MBS7044714-03 5x 0.1 mg

GATA5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-KIF1A Polyclonal Antibody
TMAB-08038-01 50 μL

Anti-KIF1A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KIF1A Polyclonal Antibody
TMAB-08038-02 100 µL

Anti-KIF1A Polyclonal Antibody

Sign In for Pricing
View Details