Bacterial RPLL protein
This Bacterial RPLL protein spans the amino acid sequence from region 1-121aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RplL, M6_Spy0814, 50S ribosomal protein L7/L12
UniProt
Q5XCB4
Expression Region
1-121aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-121aaSequence Info: Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAAAAGGAEEAAKDSFDVELTSAGDKKVGVIKAVREITGLGLKEAKGLVDGAPANVKEGVAAAEAEEIKAKLEEAGATITLK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
248158-ML550 100 µL
LHX1 (LIM Homeobox 1, LIM-1, LIM1, MGC126723, MGC138141) (MaxLight 550)
Sign In for Pricing
View Details 
MBS9360015-01 48 Well
Canine Multiple C2 and Transmembrane Domain-Containing Protein 1 (MCTP1) ELISA Kit
Sign In for Pricing
View Details MBS9360015-02 96 Well
Canine Multiple C2 and Transmembrane Domain-Containing Protein 1 (MCTP1) ELISA Kit
Sign In for Pricing
View Details MBS9360015-03 5x 96 Well
Canine Multiple C2 and Transmembrane Domain-Containing Protein 1 (MCTP1) ELISA Kit
Sign In for Pricing
View Details