Human CHRNA1 protein

Acetylcholine receptor subunit alpha, ACHA_HUMAN, AChR, ACHRA, ACHRD, CHNRA, Cholinergic receptor nicotinic alpha 1 subunit, Cholinergic receptor nicotinic alpha polypeptide 1, Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle), Chrna1, CMS1A, CMS1B, CMS2A, FCCMS, Nicotinic cholinergic receptor alpha 1, SCCMS, Schizophrenia neurophysiologic defect candidate

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL