Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHRNA1 protein

This Human CHRNA1 protein spans the amino acid sequence from region 21-255aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetylcholine receptor subunit alpha, ACHA_HUMAN, AChR, ACHRA, ACHRD, CHNRA, Cholinergic receptor nicotinic alpha 1 subunit, Cholinergic receptor nicotinic alpha polypeptide 1, Cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle), Chrna1, CMS1A, CMS1B, CMS2A, FCCMS, Nicotinic cholinergic receptor alpha 1, SCCMS, Schizophrenia neurophysiologic defect candidate

UniProt

P02708

Expression Region

21-255aa

Tag

N-terminal 6xHis-Trx-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-Trx-taggedExpression Region: 21-255aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

zero HDR Plasmid (h)
sc-405408-HDR 20 µg

zero HDR Plasmid (h)

Sign In for Pricing
View Details
Atp5j 3'UTR Luciferase Stable Cell Line
TU102331 1.0 mL

Atp5j 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Serf2 (NM_011354) AAV Particle
MR220477A1V 250 µL

Mouse Serf2 (NM_011354) AAV Particle

Sign In for Pricing
View Details
Serpin A1e Protein, Mouse, Recombinant (His)
TMPJ-01069-01 5 µg

Serpin A1e Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
Serpin A1e Protein, Mouse, Recombinant (His)
TMPJ-01069-02 10 µg

Serpin A1e Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
Serpin A1e Protein, Mouse, Recombinant (His)
TMPJ-01069-03 20 µg

Serpin A1e Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details