Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DOCK8 protein

This Mouse DOCK8 protein spans the amino acid sequence from region 561-730aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dock8Dedicator of cytokinesis protein 8

UniProt

Q8C147

Expression Region

561-730aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 561-730aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sheep Ferritin Heavy Chain (FTH1)
AP1C127-01 1 mg

Recombinant Sheep Ferritin Heavy Chain (FTH1)

Sign In for Pricing
View Details
Recombinant Sheep Ferritin Heavy Chain (FTH1)
AP1C127-02 10 µg

Recombinant Sheep Ferritin Heavy Chain (FTH1)

Sign In for Pricing
View Details
Recombinant Sheep Ferritin Heavy Chain (FTH1)
AP1C127-03 200 µg

Recombinant Sheep Ferritin Heavy Chain (FTH1)

Sign In for Pricing
View Details
Recombinant Sheep Ferritin Heavy Chain (FTH1)
AP1C127-04 5 mg

Recombinant Sheep Ferritin Heavy Chain (FTH1)

Sign In for Pricing
View Details
Recombinant Sheep Ferritin Heavy Chain (FTH1)
AP1C127-05 50 µg

Recombinant Sheep Ferritin Heavy Chain (FTH1)

Sign In for Pricing
View Details
STRO-1 Antibody (APC)
orb179924 0.1 mg

STRO-1 Antibody (APC)

Sign In for Pricing
View Details