Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DOCK8 protein

This Mouse DOCK8 protein spans the amino acid sequence from region 561-730aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dock8Dedicator of cytokinesis protein 8

UniProt

Q8C147

Expression Region

561-730aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 561-730aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon-like Peptide 1 (GLP1) (MaxLight 750) discontinued
G2040-35-ML750 10 µL

Glucagon-like Peptide 1 (GLP1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-PRDX5 Antibody (R1T87)
RHD86401 100 μg

Anti-PRDX5 Antibody (R1T87)

Sign In for Pricing
View Details
IRS1 Protein Vector (Mouse) (pPM-C-HA)
PV192336 500 ng

IRS1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GNAT2 Antibody, Biotin Conjugated
MBS7113003-01 0.05 mg

GNAT2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
GNAT2 Antibody, Biotin Conjugated
MBS7113003-02 0.1 mg

GNAT2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
GNAT2 Antibody, Biotin Conjugated
MBS7113003-03 5x 0.1 mg

GNAT2 Antibody, Biotin Conjugated

Sign In for Pricing
View Details