Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RANBP2 protein

This Human RANBP2 protein spans the amino acid sequence from region 2601-2802aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2

UniProt

P49792

Expression Region

2601-2802aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 2601-2802aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SEC14L1 sgRNA gene knockout kit - Lentiviral human SEC14L1 sgRNA gene knockout kit (100)
GTR15397771 1 Vial

Lentiviral human SEC14L1 sgRNA gene knockout kit - Lentiviral human SEC14L1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ECI2 Rabbit pAb
A9422 200 µL

ECI2 Rabbit pAb

Sign In for Pricing
View Details
MED27 siRNA (Mouse)
MBS8214163-01 15 nmol

MED27 siRNA (Mouse)

Sign In for Pricing
View Details
MED27 siRNA (Mouse)
MBS8214163-02 30 nmol

MED27 siRNA (Mouse)

Sign In for Pricing
View Details
MED27 siRNA (Mouse)
MBS8214163-03 5x 30 nmol

MED27 siRNA (Mouse)

Sign In for Pricing
View Details
CRACR2A Rabbit Polyclonal Antibody (FITC)
orb2114415 100 µL

CRACR2A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details