Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTMA protein

This Human PTMA protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMSA

UniProt

P06454

Expression Region

1-111aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 1-111aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)
MBS1137957-01 0.02 mg (E-Coli)

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)
MBS1137957-02 0.1 mg (E-Coli)

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)
MBS1137957-03 0.02 mg (Yeast)

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)
MBS1137957-04 0.1 mg (Yeast)

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)
MBS1137957-05 0.02 mg (Baculovirus)

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)
MBS1137957-06 0.02 mg (Mammalian-Cell)

Recombinant Ochrobactrum anthropi Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details