Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTMA protein

This Human PTMA protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMSA

UniProt

P06454

Expression Region

1-111aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 1-111aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HE4/Wfdc2 Antibody , Dylight550 Conjugate
A02685-5-Dylight550 100 µg

Anti-HE4/Wfdc2 Antibody , Dylight550 Conjugate

Sign In for Pricing
View Details
Anti-FoxO4/Afx Rabbit Monoclonal Antibody, Carrier-free
M01819-carrier-free 100 µL

Anti-FoxO4/Afx Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Human F-Box Protein 32 (FBXO32) ELISA Kit
orb778182-01 48 Tests

Human F-Box Protein 32 (FBXO32) ELISA Kit

Sign In for Pricing
View Details
Human F-Box Protein 32 (FBXO32) ELISA Kit
orb778182-02 96 Tests

Human F-Box Protein 32 (FBXO32) ELISA Kit

Sign In for Pricing
View Details
CFHL1 Rabbit pAb, IRDye 800CW conjugated
orb2864500 100 µL

CFHL1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Huh-7.5.1 Cell Line
RWT-1040 1x 10^6

Huh-7.5.1 Cell Line

Sign In for Pricing
View Details