Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PTMA protein

This Human PTMA protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMSA

UniProt

P06454

Expression Region

1-111aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-111aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Kv3.3 Antibody [FITC]
NBP3-05792F 0.1 mL

Rabbit Polyclonal Kv3.3 Antibody [FITC]

Sign In for Pricing
View Details
Tibulizumab ELISA Kit
E55K0566 96 Tests

Tibulizumab ELISA Kit

Sign In for Pricing
View Details
TRIM66 Human shRNA Plasmid Kit (Locus ID 9866)
TL321439 1 Kit

TRIM66 Human shRNA Plasmid Kit (Locus ID 9866)

Sign In for Pricing
View Details
Standard solution nitrate 1000 mg/l (500 ml bottle)
HI4013-53 500 mL

Standard solution nitrate 1000 mg/l (500 ml bottle)

Sign In for Pricing
View Details
TMEM209 Antibody (Biotin)
orb26007-01 50 µg

TMEM209 Antibody (Biotin)

Sign In for Pricing
View Details
TMEM209 Antibody (Biotin)
orb26007-02 100 µg

TMEM209 Antibody (Biotin)

Sign In for Pricing
View Details