Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRDX2 protein

This Human PRDX2 protein spans the amino acid sequence from region 2-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor B

UniProt

P32119

Expression Region

2-198aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 2-198aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin B / PPP3R1 (BE2.1), CF594 conjugate, 0.1mg/mL
BNC942321-500 1x 500 µL

Calcineurin B / PPP3R1 (BE2.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF405S conjugate, 0.1mg/mL
BNC042394-100 1x 100 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIR3DL1 Polyclonal Antibody
E-AB-19041-01 20 µL

KIR3DL1 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3DL1 Polyclonal Antibody
E-AB-19041-02 60 µL

KIR3DL1 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3DL1 Polyclonal Antibody
E-AB-19041-03 120 µL

KIR3DL1 Polyclonal Antibody

Sign In for Pricing
View Details
KIR3DL1 Polyclonal Antibody
E-AB-19041-04 200 µL

KIR3DL1 Polyclonal Antibody

Sign In for Pricing
View Details