Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSTB protein

This Human CSTB protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CPI-B Liver thiol proteinase inhibitor Stefin-B

UniProt

P04080

Expression Region

1-98aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-98aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human P2X purinoceptor 6, P2RX6 ELISA KIT
ELI-23283h 96 Tests

Human P2X purinoceptor 6, P2RX6 ELISA KIT

Sign In for Pricing
View Details
TEF-3 CRISPR Activation Plasmid (m2)
sc-423329-ACT-2 20 µg

TEF-3 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
PLSCR1 Polyclonal Antibody
MBS8573042-01 0.1 mL

PLSCR1 Polyclonal Antibody

Sign In for Pricing
View Details
PLSCR1 Polyclonal Antibody
MBS8573042-02 0.1 mL (AF405L)

PLSCR1 Polyclonal Antibody

Sign In for Pricing
View Details
PLSCR1 Polyclonal Antibody
MBS8573042-03 0.1 mL (AF405S)

PLSCR1 Polyclonal Antibody

Sign In for Pricing
View Details
PLSCR1 Polyclonal Antibody
MBS8573042-04 0.1 mL (AF610)

PLSCR1 Polyclonal Antibody

Sign In for Pricing
View Details