Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRSS21 protein

This Human PRSS21 protein spans the amino acid sequence from region 42-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eosinophil serine protease 1

UniProt

Q9Y6M0

Expression Region

42-288aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 42-288aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HFM1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15471R-BF594 100 µL

HFM1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
G3PP/PGP CRISPR Activation Plasmid (m)
sc-426365-ACT 20 µg

G3PP/PGP CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CYB5R3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62609R-BF555 100 µL

CYB5R3 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Human PLEKHG7 Pre-designed siRNA Set A
SI012351A 1 Each

Human PLEKHG7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal MFSD12 Antibody
NBP2-48783-25ul 25 µL

Rabbit Polyclonal MFSD12 Antibody

Sign In for Pricing
View Details
Recombinant Human Fibroblast Growth Factor-21, His Tag
7-00386 50 µg

Recombinant Human Fibroblast Growth Factor-21, His Tag

Sign In for Pricing
View Details