Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRSS21 protein

This Human PRSS21 protein spans the amino acid sequence from region 42-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eosinophil serine protease 1

UniProt

Q9Y6M0

Expression Region

42-288aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 42-288aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levosimendan Cyanoacetate Hydrazone Impurity
TRC-L378005-100MG 100 mg

Levosimendan Cyanoacetate Hydrazone Impurity

Sign In for Pricing
View Details
OR2H2 CRISPR/Cas9 KO Plasmid (h)
sc-417729 20 µg

OR2H2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anti-PUMA Antibody
MBS821506-01 0.03 mL

Anti-PUMA Antibody

Sign In for Pricing
View Details
Anti-PUMA Antibody
MBS821506-02 0.05 mL

Anti-PUMA Antibody

Sign In for Pricing
View Details
Anti-PUMA Antibody
MBS821506-03 0.1 mL

Anti-PUMA Antibody

Sign In for Pricing
View Details
Anti-PUMA Antibody
MBS821506-04 0.2 mL

Anti-PUMA Antibody

Sign In for Pricing
View Details