Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse FLII protein

This Mouse FLII protein spans the amino acid sequence from region 495-827aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Flii, Fli1, FliihProtein flightless-1 homolog

UniProt

Q9JJ28

Expression Region

495-827aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 495-827aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVLGGEPSEIKNHVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Matrix Metalloproteinase 19 ELISA Kit
MBS7255396-01 48 Well

Rat Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 19 ELISA Kit
MBS7255396-02 96 Well

Rat Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 19 ELISA Kit
MBS7255396-03 5x 96 Well

Rat Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Rat Matrix Metalloproteinase 19 ELISA Kit
MBS7255396-04 10x 96 Well

Rat Matrix Metalloproteinase 19 ELISA Kit

Sign In for Pricing
View Details
Ciliary neurotrophic factor
AP82053 1 mg

Ciliary neurotrophic factor

Sign In for Pricing
View Details
RPMI-1640 Medium (Dutch Modification)
abx704817 500 mL

RPMI-1640 Medium (Dutch Modification)

Sign In for Pricing
View Details