Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial LYTA protein

This Bacterial LYTA protein spans the amino acid sequence from region 1-481aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-acetylmuramoyl-L-alanine amidase

UniProt

P24556

Expression Region

1-481aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Staphylococcus aureus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-481aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAKLTKNEFIERLKTSEGKQFNVDLWYGFQCFDYANAGWKVLFGLLLKGLGAKDIPFANNFDGLATVYQNTPDFLAQPGDMVVFGSNYGAGYGHVAWVIEATLDYIIVYEQNWLGGGWTDGIEQPAGVGKKLQDDNMLMISLCGLSVRILKVRQRHDQFNLLHKHPKKETAKPQPKAVELKIIKDVVKGYDLPKRGSNPKGIVIHNDAGSKGATAEAYRNGLVNAPLSRLEAGIAHSYVSGNTVWQALDESQVGWHTANQIGNKYYYGIEVCQSMGADNATFLKNEQATFQECARLLKKWGLPANRNTIRLHNEFTSTSCPHRSSVLHTGFDPVTRGLLPEDKRLQLKDYFIKQIRAYMDGKIPVATVSNESSASSNTVKPVASAWKRNKYGTYYMEESARFTNGNQPITVRKVGPFLSCPVGYQFQPGGYCDYTEVMLQDGHVWVGYTWEGQRYYLPIRTWNGSAPPNQILGDLWGEIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse COL4 protein (His tag)
PDMM100035-01 20 µg

Recombinant Mouse COL4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse COL4 protein (His tag)
PDMM100035-02 100 µg

Recombinant Mouse COL4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse COL4 protein (His tag)
PDMM100035-03 500 µg

Recombinant Mouse COL4 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse COL4 protein (His tag)
PDMM100035-04 1 mg

Recombinant Mouse COL4 protein (His tag)

Sign In for Pricing
View Details
THEM2 Antibody
F40235-0.08ML 0.08 mL

THEM2 Antibody

Sign In for Pricing
View Details
Recombinant Importin 9 Monoclonal Antibody
E-AB-81428-01 50 µL

Recombinant Importin 9 Monoclonal Antibody

Sign In for Pricing
View Details