Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT3 protein

This Human MT3 protein spans the amino acid sequence from region 1-68aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GIFB

UniProt

P25713

Expression Region

1-68aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 1-68aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Olfactory receptor 867 (Olr867)
MBS7024471-01 0.02 mg

Recombinant Rat Olfactory receptor 867 (Olr867)

Sign In for Pricing
View Details
Recombinant Rat Olfactory receptor 867 (Olr867)
MBS7024471-02 0.1 mg

Recombinant Rat Olfactory receptor 867 (Olr867)

Sign In for Pricing
View Details
Recombinant Rat Olfactory receptor 867 (Olr867)
MBS7024471-03 5x 0.1 mg

Recombinant Rat Olfactory receptor 867 (Olr867)

Sign In for Pricing
View Details
Anti-Complement C4 A Antibody (6F699)
TMAS-00229-01 50 μL

Anti-Complement C4 A Antibody (6F699)

Sign In for Pricing
View Details
Anti-Complement C4 A Antibody (6F699)
TMAS-00229-02 100 µL

Anti-Complement C4 A Antibody (6F699)

Sign In for Pricing
View Details
EBLN2 Antibody
orb1315147-01 30 µL

EBLN2 Antibody

Sign In for Pricing
View Details