Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi HFB2 protein

This Fungi HFB2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hydrophobin II

UniProt

P79073

Expression Region

16-86aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Hypocrea jecorina (Trichoderma reesei)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 16-86aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAG2 Antibody
KC-1187-01 50 μL

IRAG2 Antibody

Sign In for Pricing
View Details
IRAG2 Antibody
KC-1187-02 100 µL

IRAG2 Antibody

Sign In for Pricing
View Details
IRAG2 Antibody
KC-1187-03 1 mL

IRAG2 Antibody

Sign In for Pricing
View Details
Human Cluster Of Differentiation 109 (CD109) ELISA Kit
RD-CD109-Hu-01 96 Tests

Human Cluster Of Differentiation 109 (CD109) ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 109 (CD109) ELISA Kit
RD-CD109-Hu-02 48 Tests

Human Cluster Of Differentiation 109 (CD109) ELISA Kit

Sign In for Pricing
View Details
ICAM3 Mouse Monoclonal Antibody [Clone ID: JA4]
AM33037PU-N 100 µg

ICAM3 Mouse Monoclonal Antibody [Clone ID: JA4]

Sign In for Pricing
View Details