Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Large delta antigen protein

This Viral Large delta antigen protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P27

UniProt

P0C6L6

Expression Region

1-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-211aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromodeoxyuridine (BrdU) (Proliferation Marker) (rBRD469), 1mg/mL
BNUM1538-50 1x 50 µL

Bromodeoxyuridine (BrdU) (Proliferation Marker) (rBRD469), 1mg/mL

Sign In for Pricing
View Details
CYB5B Polyclonal Antibody
A62362-020 20 µL

CYB5B Polyclonal Antibody

Sign In for Pricing
View Details
SLC19A1 shRNA (m2) Lentiviral Particles
sc-61463-V 200 µL

SLC19A1 shRNA (m2) Lentiviral Particles

Sign In for Pricing
View Details
Anti-SOX15 Antibody Picoband®, PE Conjugate
A07722-1-PE 100 µg/Vial

Anti-SOX15 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
SLC6A20A siRNA (Mouse)
orb1838703-01 15 nmol

SLC6A20A siRNA (Mouse)

Sign In for Pricing
View Details
SLC6A20A siRNA (Mouse)
orb1838703-02 30 nmol

SLC6A20A siRNA (Mouse)

Sign In for Pricing
View Details