Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Large delta antigen protein

This Viral Large delta antigen protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P27

UniProt

P0C6L6

Expression Region

1-211aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Hepatitis delta virus genotype I (isolate Italian) (HDV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-211aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (FITC)
MBS6387736-01 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (FITC)

Sign In for Pricing
View Details
NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (FITC)
MBS6387736-02 5x 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (FITC)

Sign In for Pricing
View Details
Dynamin 2 Rabbit Polyclonal Antibody (APC)
orb995208 100 µL

Dynamin 2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
RITA Polyclonal Antibody, Cy3 Conjugated
bs-11945R-Cy3 100 µL

RITA Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
HCCS siRNA (h)
sc-91122 10 µM

HCCS siRNA (h)

Sign In for Pricing
View Details
ALDH3A1 Rabbit Polyclonal Antibody (BF350)
orb2505501 100 µL

ALDH3A1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details