Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial PRGJ protein

This Bacterial PRGJ protein spans the amino acid sequence from region 1-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PrgJ, STM2872Protein PrgJ

UniProt

P41785

Expression Region

1-101aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-sumostar-taggedExpression Region: 1-101aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix metalloproteinase 9 Antibody / MMP9
V7961-100UG 100 µg

Matrix metalloproteinase 9 Antibody / MMP9

Sign In for Pricing
View Details
CD367/CLEC4A, Rat (HEK293, His)
HY-P77332-01 5 µg

CD367/CLEC4A, Rat (HEK293, His)

Sign In for Pricing
View Details
CD367/CLEC4A, Rat (HEK293, His)
HY-P77332-02 10 µg

CD367/CLEC4A, Rat (HEK293, His)

Sign In for Pricing
View Details
CD367/CLEC4A, Rat (HEK293, His)
HY-P77332-03 50 µg

CD367/CLEC4A, Rat (HEK293, His)

Sign In for Pricing
View Details
CD367/CLEC4A, Rat (HEK293, His)
HY-P77332-04 100 µg

CD367/CLEC4A, Rat (HEK293, His)

Sign In for Pricing
View Details
ATP7B Antibody
MBS9600320-01 0.1 mL

ATP7B Antibody

Sign In for Pricing
View Details